PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00147590001
Common NameGSBRNA2T00147590001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 295aa    MW: 31855.9 Da    PI: 8.3386
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00147590001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box223.3e-07436436
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                         + C+ +++  + l+C+ +  +lC +C ++ H  
  GSBRNA2T00147590001  4 KLCDSCKSATAALYCRPDAAFLCLSCDSKVHAA 36
                         68***************************9954 PP

2zf-B_box27.85.2e-094691342
             zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                          ++C+ +e+ +++  C+ +   lC +C   +H+       H++vp+
  GSBRNA2T00147590001 46 VWMCEVCEQAPAHVTCKADAAALCVTCDRDIHSAnplarrHERVPV 91
                         689*****************************66899999*99986 PP

3CCT70.44.5e-24226269144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          Rea+++RY+eKrk+RkFeK+irY+sRKa+Ae RpR+KGrF+k++
  GSBRNA2T00147590001 226 REARVMRYREKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRT 269
                          9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.2E-13148IPR000315B-box-type zinc finger
PROSITE profilePS5011910.438148IPR000315B-box-type zinc finger
PfamPF006432.3E-5443IPR000315B-box-type zinc finger
CDDcd000219.56E-9548No hitNo description
PROSITE profilePS5011910.8934491IPR000315B-box-type zinc finger
PfamPF006432.5E-74691IPR000315B-box-type zinc finger
CDDcd000211.06E-94791No hitNo description
SMARTSM003361.3E-104991IPR000315B-box-type zinc finger
PfamPF062035.2E-18226268IPR010402CCT domain
PROSITE profilePS5101716.767226268IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MASKLCDSCK SATAALYCRP DAAFLCLSCD SKVHAANKLA SRHARVWMCE VCEQAPAHVT  60
CKADAAALCV TCDRDIHSAN PLARRHERVP VTPFYDSAAS WLLPNPKTTT AVATAAEAVP  120
GDSPEMNTGQ QYLFPDLDLD YGTNRTVKVA TVNENCYELD FTGGSKGFTY GYNSISHSQV  180
SSSSLEVGVV PDGGSVADVS YPYGGAATSV TDPGTQRAVP LTAAEREARV MRYREKRKNR  240
KFEKTIRYAS RKAYAEMRPR IKGRFAKRTD TNDSNDVVVG HGGIFSGFGL VPTF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.18831e-106flower| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00147590001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013706149.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like isoform X1
SwissprotQ940T91e-174COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A078DG310.0A0A078DG31_BRANA; BnaA06g27360D protein
STRINGBra009805.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27602765
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-165CONSTANS-like 4
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]